TP4A2_MOUSE O70274
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:O70274
Recommended name：Protein tyrosine phosphatase type IVA 2
EC number：EC 3.1.3.48
Alternative names：(Protein-tyrosine phosphatase 4a2) (Protein-tyrosine phosphatase of regenerating liver 2) (PRL-2)
Cleaved into：
GeneID：19244
Gene names (primary )：Ptp4a2
Gene names (synonym )：Prl2
Gene names (ORF )：
Length：167
Mass：19127
Sequence：MNRPAPVEISYENMRFLITHNPTNATLNKFTEELKKYGVTTLVRVCDATYDKAPVEKEGIHVLDWPFDDGAPPPNQIVDDWLNLLKTKFREEPGCCVAVHCVAGLGRAPVLVALALIECGMKYEDAVQFIRQKRRGAFNSKQLLYLEKYRPKMRLRFRDTNGHCCVQ
Tissue specificity：Expressed in skeletal muscle, and at lower levels in liver, lung, heart, kidney, brain, testis and spleen. {ECO:0000269|PubMed:9514946}.
Induction：
Developmental stage：
Protein families：Protein-tyrosine phosphatase family