IFNG_HUMAN   P01579


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:P01579

Recommended name:Interferon gamma

EC number:

Alternative names:(IFN-gamma) (Immune interferon)

Cleaved into:

GeneID:3458

Gene names  (primary ):IFNG

Gene names  (synonym ):

Gene names  (ORF ):

Length:166

Mass:19348

Sequence:MKYTSYILAFQLCIVLGSLGCYCQDPYVKEAENLKKYFNAGHSDVADNGTLFLGILKNWKEESDRKIMQSQIVSFYFKLFKNFKDDQSIQKSVETIKEDMNVKFFNSNKKKRDDFEKLTNYSVTDLNVQRKAIHELIQVMAELSPAAKTGKRKRSQMLFRGRRASQ

Tissue specificity:Released primarily from activated T lymphocytes.

Induction:

Developmental stage:

Protein families:Type II (or gamma) interferon family


   💬 WhatsApp