IFNAD_MOUSE Q80SU4
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q80SU4
Recommended name:Interferon alpha-13
EC number:
Alternative names:(IFN-alpha-13)
Cleaved into:
GeneID:230396
Gene names (primary ):Ifna13
Gene names (synonym ):
Gene names (ORF ):
Length:189
Mass:21567
Sequence:MARPCAFLMVLVVLSYWSACSLGCDLPQTHNLRNKRALTLLEQMRRLSPLSCLKDRKDFGFPQEKVDAQQIKKAQAIPFVHELTQQILTLFTSNDSSAAWNATLLDSFCNDLHQQLNDLKACLMQQVGVQEFPLTQEDSLLAVRKYFHSITVYLREKKHSPCAWEVVRAEVQRTLSSSANLLARLSKEE
Tissue specificity:
Induction:Transcribed constitutively. Not induces by viral infection. {ECO:0000269|PubMed:12930842}.
Developmental stage:
Protein families:Alpha/beta interferon family