VIAAT_RAT O35458
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:O35458
Recommended name：Vesicular inhibitory amino acid transporter
EC number：
Alternative names：
Cleaved into：
GeneID：83612
Gene names (primary )：Slc32a1
Gene names (synonym )：Vgat, Viaat
Gene names (ORF )：
Length：525
Mass：57,407
Sequence：MATLLRSKLTNVATSVSNKSQAKVSGMFARMGFQAATDEEAVGFAHCDDLDFEHRQGLQMDILKSEGEPCGDEGAEPPVEGDIHYQRGGAPLPPSGSKDQAVGAGGEFGGHDKPKITAWEAGWNVTNAIQGMFVLGLPYAILHGGYLGLFLIIFAAVVCCYTGKILIACLYEENEDGEVVRVRDSYVAIANACCAPRFPTLGGRVVNVAQIIELVMTCILYVVVSGNLMYNSFPGLPVSQKSWSIIATAVLLPCAFLKNLKAVSKFSLLCTLAHFVINILVIAYCLSRARDWAWEKVKFYIDVKKFPISIGIIVFSYTSQIFLPSLEGNMQQPSEFHCMMNWTHIAACVLKGLFALVAYLTWADETKEVITDNLPGSIRAVVNIFLVAKALLSYPLPFFAAVEVLEKSLFQEGSRAFFPACYGGDGRLKSWGLTLRCALVVFTLLMAIYVPHFALLMGLTGSLTGAGLCFLLPSLFHLRLLWRKLLWHQVFFDVAIFVIGGICSVSGFVHSLEGLIEAYRTNAED
Tissue specificity：Brain (PubMed:9349821, PubMed:9822734). Expressed at high levels within the neocortex, hippocampus, cerebellum, striatum, septal nuclei and the reticular nucleus of the thalamus (PubMed:9349821). Also expressed in islets where it is more abundant in the peripheral/mantle region (PubMed:12031963). Highly expressed in the nerve endings of GABA neurons in the brain and spinal cord but also in glycinergic nerve endings (PubMed:9822734). Expressed in glycine-, GABA- or GABA- and glycine-containing boutons (PubMed:10036231, PubMed:9822734). 4 s
Induction：
Developmental stage：
Protein families：