JUNO_HUMAN   A6ND01


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:A6ND01

Recommended name:Sperm-egg fusion protein Juno

EC number:

Alternative names:(Folate receptor 4) (Folate receptor delta) (FR-delta) (IZUMO1 receptor protein JUNO)

Cleaved into:

GeneID:390243

Gene names  (primary ):IZUMO1R

Gene names  (synonym ):FOLR4 JUNO

Gene names  (ORF ):

Length:250

Mass:28672

Sequence:MACWWPLLLELWTVMPTWAGDELLNICMNAKHHKRVPSPEDKLYEECIPWKDNACCTLTTSWEAHLDVSPLYNFSLFHCGLLMPGCRKHFIQAICFYECSPNLGPWIQPVGSLGWEVAPSGQGERVVNVPLCQEDCEEWWEDCRMSYTCKSNWRGGWDWSQGKNRCPKGAQCLPFSHYFPTPADLCEKTWSNSFKASPERRNSGRCLQKWFEPAQGNPNVAVARLFASSAPSWELSYTIMVCSLFLPFLS

Tissue specificity:

Induction:

Developmental stage:

Protein families:Folate receptor family


   💬 WhatsApp