VA0D1_HUMAN P61421
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:P61421
Recommended name：V-type proton ATPase subunit d 1
EC number：
Alternative names：(V-ATPase subunit d 1) (32 kDa accessory protein) (V-ATPase 40 kDa accessory protein) (V-ATPase AC39 subunit) (p39) (Vacuolar proton pump subunit d 1)
Cleaved into：
GeneID：9114
Gene names (primary )：ATP6V0D1
Gene names (synonym )：ATP6D VPATPD
Gene names (ORF )：
Length：351
Mass：40329
Sequence：MSFFPELYFNVDNGYLEGLVRGLKAGVLSQADYLNLVQCETLEDLKLHLQSTDYGNFLANEASPLTVSVIDDRLKEKMVVEFRHMRNHAYEPLASFLDFITYSYMIDNVILLITGTLHQRSIAELVPKCHPLGSFEQMEAVNIAQTPAELYNAILVDTPLAAFFQDCISEQDLDEMNIEIIRNTLYKAYLESFYKFCTLLGGTTADAMCPILEFEADRRAFIITINSFGTELSKEDRAKLFPHCGRLYPEGLAQLARADDYEQVKNVADYYPEYKLLFEGAGSNPGDKTLEDRFFEHEVKLNKLAFLNQFHFGVFYAFVKLKEQECRNIVWIAECIAQRHRAKIDNYIPIF
Tissue specificity：Ubiquitous. {ECO:0000269|PubMed:12384298, ECO:0000269|PubMed:8250920}.
Induction：
Developmental stage：
Protein families：V-ATPase V0D/AC39 subunit family