SAP3_MOUSE   Q60648


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q60648

Recommended name:Ganglioside GM2 activator

EC number:

Alternative names:(Cerebroside sulfate activator protein) (GM2-AP) (Sphingolipid activator protein 3) (SAP-3)

Cleaved into:

GeneID:14667

Gene names  (primary ):Gm2a

Gene names  (synonym ):

Gene names  (ORF ):

Length:193

Mass:20824

Sequence:MHRLPLLLLLGLLLAGSVAPARLVPKRLSQLGGFSWDNCDEGKDPAVIKSLTIQPDPIVVPGDVVVSLEGKTSVPLTAPQKVELTVEKEVAGFWVKIPCVEQLGSCSYENICDLIDEYIPPGESCPEPLHTYGLPCHCPFKEGTYSLPTSNFTVPDLELPSWLSTGNYRIQSILSSGGKRLGCIKIAASLKGR

Tissue specificity:Widely expressed. Most abundant in kidney and testis.

Induction:

Developmental stage:

Protein families:


   💬 WhatsApp