LAT2_MOUSE   Q9QXW9


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q9QXW9

Recommended name:Large neutral amino acids transporter small subunit 2

EC number:

Alternative names:(L-type amino acid transporter 2) (mLAT2) (Solute carrier family 7 member 8)

Cleaved into:

GeneID:50934

Gene names  (primary ):Slc7a8

Gene names  (synonym ):Lat2

Gene names  (ORF ):

Length:531

Mass:57873

Sequence:MEKGARQRNNTAKNHPGSDTSPEAEASSGGGGVALKKEIGLVSACGIIVGNIIGSGIFVSPKGVLENAGSVGLALIVWIVTGIITAVGALCYAELGVTIPKSGGDYSYVKDIFGGLAGFLRLWIAVLVIYPTNQAVIALTFSNYVLQPLFPTCFPPESGLRLLAAICLLLLTWVNCSSVRWATRVQDIFTAGKLLALALIIIMGIVQICKGEFFWLEPKNAFENFQEPDIGLVALAFLQGSFAYGGWNFLNYVTEELVDPYKNLPRAIFISIPLVTFVYVFANIAYVTAMSPQELLASNAVAVTFGEKLLGVMAWIMPISVALSTFGGVNGSLFTSSRLFFAGAREGHLPSVLAMIHVKRCTPIPALLFTCLSTLLMLVTSDMYTLINYVGFINYLFYGVTVAGQIVLRWKKPDIPRPIKVSLLFPIIYLLFWAFLLIFSLWSEPVVCGIGLAIMLTGVPVYFLGVYWQHKPKCFNDFIKSLTLVSQKMCVVVYPQEGNSGAEETTDDLEEQHKPIFKPTPVKDPDSEEQP

Tissue specificity:Strongly expressed in kidney and small intestine. Moderately present in placenta, ovary and brain. {ECO:0000269|PubMed:10574970}.

Induction:

Developmental stage:

Protein families:Amino acid-polyamine-organocation (APC) superfamily, L-type amino acid transporter (LAT) (TC 2.A.3.8) family


   💬 WhatsApp