H31T_HUMAN Q16695
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q16695
Recommended name：Histone H3.1t
EC number：
Alternative names：(H3/t) (H3t) (H3/g) (Histone H3.4)
Cleaved into：
GeneID：8290
Gene names (primary )：H3-4
Gene names (synonym )：H3FT HIST3H3
Gene names (ORF )：
Length：136
Mass：15508
Sequence：MARTKQTARKSTGGKAPRKQLATKVARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLMREIAQDFKTDLRFQSSAVMALQEACESYLVGLFEDTNLCVIHAKRVTIMPKDIQLARRIRGERA
Tissue specificity：Expressed in testicular cells.
Induction：
Developmental stage：Expressed during S phase, then expression strongly decreases as cell division slows down during the process of differentiation.
Protein families：Histone H3 family