GPX5_HUMAN   O75715


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:O75715

Recommended name:Epididymal secretory glutathione peroxidase

EC number:EC:1.11.1.9

Alternative names:(Epididymis-specific glutathione peroxidase-like protein) (EGLP) (Glutathione peroxidase 5) (GPx-5) (GSHPx-5)

Cleaved into:

GeneID:2880

Gene names  (primary ):GPX5

Gene names  (synonym ):

Gene names  (ORF ):

Length:221

Mass:25202

Sequence:MTTQLRVVHLLPLLLACFVQTSPKQEKMKMDCHKDEKGTIYDYEAIALNKNEYVSFKQYVGKHILFVNVATYCGLTAQYPELNALQEELKPYGLVVLGFPCNQFGKQEPGDNKEILPGLKYVRPGGGFVPSFQLFEKGDVNGEKEQKVFSFLKHSCPHPSEILGTFKSISWDPVKVHDIRWNFEKFLVGPDGIPVMRWSHRATVSSVKTDILAYLKQFKTK

Tissue specificity:Epididymis.

Induction:

Developmental stage:

Protein families:Glutathione peroxidase family


   💬 WhatsApp