SIA7F_MOUSE Q9JM95
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q9JM95
Recommended name：Alpha-N-acetylgalactosaminide alpha-2,6-sialyltransferase 6
EC number：EC 2.4.99.-
Alternative names：(GalNAc alpha-2,6-sialyltransferase VI) (ST6GalNAc VI) (ST6GalNAcVI) (Sialyltransferase 7F) (SIAT7-F)
Cleaved into：
GeneID：50935
Gene names (primary )：St6galnac6
Gene names (synonym )：Siat7f
Gene names (ORF )：
Length：333
Mass：38167
Sequence：MACSRPPSQCDPTTLPPGPPAGRWPLPFSRRRREMSSNKEQRSAVFVILFALITILILYSSNSANEVFHYGSLRGRTRRPVNLKKWSFSSAYFPILGNKTLPSRCNQCVIITSSSHLLGTKLGPEIERAECTIRMNDAPTSGYSADVGNKTTFRVVAHSSVFRVLRKPQEFVNRTPETVFIFWGPPNKMQKPQGSLLRVIQRAGLMFPNMEAYAVSPARMQQFDDLFRGETGKDREKSHSWLSTGWFTMVIAVELCDHVHVYGMVPPDYCSQRPRLQRMPYHYYEPKGPDECVTYIQNEHSRKGNHHRFITEKRVFSSWAQLYGITFSHPSWT
Tissue specificity：Widely expressed, the gene expression is most abundant in colon, brain, liver, and heart. {ECO:0000269|PubMed:10702226}.
Induction：After inflammation stimulus. {ECO:0000269|PubMed:15858074}.
Developmental stage：
Protein families：Glycosyltransferase 29 family