TPC6B_MOUSE   Q9D289


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q9D289

Recommended name:Trafficking protein particle complex subunit 6B

EC number:

Alternative names:(TRAPP complex subunit 6B)

Cleaved into:

GeneID:78232

Gene names  (primary ):Trappc6b

Gene names  (synonym ):

Gene names  (ORF ):

Length:158

Mass:17936

Sequence:MADEALFLLLHNEMVSGVYKSAEQGEVENGRCVTKLESMGFRVGQGLIERFTKDTARFKDELDIMKFICKDFWTTVFKKQIDNLRTNHQGIYVLQDNKFRLLIQLSAGKQYLEHASKYLAFTCGLIRGGLSNLGIKSIVTAEVSSMPACKFQVMIQKL

Tissue specificity:Widely expressed. Expressed in lung, heart, liver, spleen, brain and kidney. {ECO:0000269|PubMed:16828797}.

Induction:

Developmental stage:

Protein families:TRAPP small subunits family, BET3 subfamily


   💬 WhatsApp