CAR19_HUMAN   Q96LW7


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q96LW7

Recommended name:Caspase recruitment domain-containing protein 19

EC number:

Alternative names:(Bcl10-interacting CARD protein) (BinCARD)

Cleaved into:

GeneID:84270

Gene names  (primary ):CARD19

Gene names  (synonym ):C9orf89

Gene names  (ORF ):

Length:228

Mass:25589

Sequence:MTDQTYCDRLVQDTPFLTGHGRLSEQQVDRIILQLNRYYPQILTNKEAEKFRNPKASLRVRLCDLLSHLQRSGERDCQEFYRALYIHAQPLHSRLPSRHALRKFHITNHACLVLARGGHPSLPLMAWMSSMTTQVCCSPGLASPLASAPPQRPPSGPEGRVWQAQAVQMLVSVSHFLPLPPSLSHGSFHTAWGILYVHSCPSFSNLIPRGSLHVCVDSNLVPTAAWRS

Tissue specificity:Expressed in ovary, testis, placenta, skeletal muscle, kidney, lung, heart and liver (at protein level). Expressed in thymus and brain. {ECO:0000269|PubMed:15637807}.

Induction:

Developmental stage:

Protein families:


   💬 WhatsApp