M4A6C_MOUSE   Q99N08


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q99N08

Recommended name:Membrane-spanning 4-domains subfamily A member 6C

EC number:

Alternative names:

Cleaved into:

GeneID:73656

Gene names  (primary ):Ms4a6c

Gene names  (synonym ):

Gene names  (ORF ):

Length:217

Mass:23622

Sequence:MIPQVVTNETITTISPNGINFPQKDESQPTQQRQDSLKKHLKAEIKVIVAIQIMCAVTVLALGIILASVPPVPYFNSVFSVLLKSGYPFIGALFFIASGILSIITERKSTKPLVDASLTLNILSVSFAFVGIIIISVSLAGLHPASEQCKQSKELSLIEHDYYQPFYNSDRSECAVTKSILTGALSVMLIISVLELGLALLSAMLWLREGVLTSLRM

Tissue specificity:Expressed only by thymus, spleen, peripheral lymph node and bone marrow.

Induction:

Developmental stage:

Protein families:MS4A family


   💬 WhatsApp