CYH3_RAT P97696
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:P97696
Recommended name：Cytohesin-3
EC number：
Alternative names：
Cleaved into：
GeneID：
Gene names (primary )：Cyth3
Gene names (synonym )：Pscd3, Sec7c
Gene names (ORF )：
Length：400
Mass：46,337
Sequence：MDEGGGGEGGSVPEDLSLEEREELLDIRRRKKELIDDIERLKYEIAEVMTEIDNLTSVEESKTTQRNKQIAMGRKKFNMDPKKGIQFLIENDLLQSSPEDVAQFLYKGEGLNKTVIGDYLGERDDFNIKVLQAFVELHEFADLNLVQALRQFLWSFRLPGEAQKIDRMMEAFASRYCLCNPGVFQSTDTCYVLSFAIIMLNTSLHNHNVRDKPTAERFITMNRGINEGGDLPEELLRNLYESIKNEPFKIPEDDGNDLTHTFFNPDREGWLLKLGGGRVKTWKRRWFILTDNCLYYFEYTTDKEPRGIIPLENLSIREVEDPRKPNCFELYNPSHKGQVIKACKTEADGRVVEGNHVVYRISAPSPEEKEEWMKSIKASISRDPFYDMLATRKRRIANKK
Tissue specificity：Present in all tissues tested, with highest protein levels in brain and adrenal.
Induction：
Developmental stage：On embryonic days 15 (15 dpc) and 18 dpc, expressed in the cortical plate of the cerebrum. On postnatal days 0 (P0) and P7, a moderate expression is seen in the cerebral neocortex, hippocampal pyramidal and dentate granule cell layers. In the cerebellum, expressed in the cerebellar Purkinje cells. On P14, a decreased expression is seen throughout the brain. On P21, expression is seen in the cerebellar Purkinje cells, dentate granule cells and the hippocampal pyramidal cells. 1
Protein families：