MUC24_HUMAN   Q04900


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q04900

Recommended name:Sialomucin core protein 24

EC number:

Alternative names:(MUC-24) (Endolyn) (Multi-glycosylated core protein 24) (MGC-24) (MGC-24v) (CD antigen CD164)

Cleaved into:

GeneID:8763

Gene names  (primary ):CD164

Gene names  (synonym ):

Gene names  (ORF ):

Length:197

Mass:20917

Sequence:MSRLSRSLLWAATCLGVLCVLSADKNTTQHPNVTTLAPISNVTSAPVTSLPLVTTPAPETCEGRNSCVSCFNVSVVNTTCFWIECKDESYCSHNSTVSDCQVGNTTDFCSVSTATPVPTANSTAKPTVQPSPSTTSKTVTTSGTTNNTVTPTSQPVRKSTFDAASFIGGIVLVLGVQAVIFFLYKFCKSKERNYHTL

Tissue specificity:Isoform 1 and isoform 3 are expressed in hematopoietic and non-hematopoietic tissues. Isoform 1 is expressed by prostate cancer tumors and prostate cancer cell lines. The expression is greater in bone metastases than in primary tumors. Expression in osseous metastasis is greater than that in soft tissue metastasis. Isoform 2 is expressed in the small intestine, colon, lung, thyroid and in colorectal and pancreatic adenocarcinoma. Isoform 4 is expressed by both hematopoietic progenitor cells and bone marrow stromal cells. {ECO:0000269|PubMed:10878358, ECO:0000269|PubMed:11027692, ECO:0000269|PubMed:1478919, ECO:0000269|PubMed:16859559, ECO:0000269|PubMed:9763543}.

Induction:Up-regulated by CXCL12 in prostate cancer cell lines. {ECO:0000269|PubMed:16859559}.

Developmental stage:

Protein families:CD164 family


   💬 WhatsApp