K1C10_MOUSE P02535
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:P02535
Recommended name:Keratin, type I cytoskeletal 10
EC number:
Alternative names:(56 kDa cytokeratin) (Cytokeratin-10) (CK-10) (Keratin, type I cytoskeletal 59 kDa) (Keratin-10) (K10)
Cleaved into:
GeneID:16661
Gene names (primary ):Krt10
Gene names (synonym ):Krt1-10
Gene names (ORF ):
Length:570
Mass:57770
Sequence:MSVLYSSSSKQFSSSRSGGGGGGGSVRVSSTRGSLGGGYSSGGFSGGSFSRGSSGGGCFGGSSGGYGGFGGGGSFGGGYGGSSFGGGYGGSSFGGGYGGSSFGGAGFGGGGSFGGGSFGGGSYGGGFGGGGFGGDGGSLLSGNGRVTMQNLNDRLASYMDKVRALEESNYELEGKIKEWYEKHGNSSQREPRDYSKYYKTIEDLKGQILTLTTDNANVLLQIDNARLAADDFRLKYENEVTLRQSVEADINGLRRVLDELTLSKSDLEMQIESLNEELAYLKKNHEEEMRDLQNVSTGDVNVEMNAAPGVDLTQLLNNMRNQYEQLAEKNRKDAEEWFNQKSKELTTEIDSNIEQMSSHKSEITELRRTVQGLEIELQSQLALKQSLEASLAETEGRYCVQLSQIQSQISALEEQLQQIRAETECQNAEYQQLLDIKTRLENEIQTYRSLLEGEGSSSGGGGGRRGGSGGGSYGGSSGGGSYGGSSGGGGSYGGSSGGGGSYGGGSSGGGSHGGSSGGGYGGGSSSGGAGGHGGSSGGGYGGGSSSGGQGGSGGFKSSGGGDQSSKGPRY
Tissue specificity:Expressed in the suprabasal layers of the epidermis throughout the entire sole (at protein level) (PubMed:26603179). Expressed in lung tissue from young mice (at protein level) (PubMed:19627498). {ECO:0000269|PubMed:19627498, ECO:0000269|PubMed:26603179}.
Induction:
Developmental stage:
Protein families:Intermediate filament family