FAM9C_HUMAN   Q8IZT9


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q8IZT9

Recommended name:Protein FAM9C

EC number:

Alternative names:

Cleaved into:

GeneID:171484

Gene names  (primary ):FAM9C

Gene names  (synonym ):

Gene names  (ORF ):

Length:166

Mass:19210

Sequence:MAAKDQLEVQVMAAQEMELAGKDPVSHEHEERKPVTETKEGDVTDEHGERGSFAETDEHTGVDTKELEDIAADIKEHLAAKRKRIEKIAKACSEIKNRIKNVLRTTQLKRQKRDYRISLKLPNVLEEFITDEQKDEEGDGEKEEQIKIFQEQQKRWQQDGKGTERD

Tissue specificity:Expressed exclusively in testis. {ECO:0000269|PubMed:12213195}.

Induction:

Developmental stage:

Protein families:FAM9 family


   💬 WhatsApp