GHR_MOUSE P16882
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:P16882
Recommended name：Growth hormone receptor
EC number：
Alternative names：(GH receptor) (Somatotropin receptor)
Cleaved into：Growth hormone-binding protein (GH-binding protein) (GHBP) (Serum-binding protein)
GeneID：14600
Gene names (primary )：Ghr
Gene names (synonym )：
Gene names (ORF )：
Length：650
Mass：72783
Sequence：MDLCQVFLTLALAVTSSTFSGSEATPATLGKASPVLQRINPSLGTSSSGKPRFTKCRSPELETFSCYWTEGDNPDLKTPGSIQLYYAKRESQRQAARIAHEWTQEWKECPDYVSAGKNSCYFNSSYTSIWIPYCIKLTTNGDLLDQKCFTVDEIVQPDPPIGLNWTLLNISLTGIRGDIQVSWQPPPNADVLKGWIILEYEIQYKEVNESKWKVMGPIWLTYCPVYSLRMDKEHEVRVRSRQRSFEKYSEFSEVLRVIFPQTNILEACEEDIQFPWFLIIIFGIFGVAVMLFVVIFSKQQRIKMLILPPVPVPKIKGIDPDLLKEGKLEEVNTILGIHDNYKPDFYNDDSWVEFIELDIDEADVDEKTEGSDTDRLLSNDHEKSAGILGAKDDDSGRTSCYDPDILDTDFHTSDMCDGTLKFRQSQKLNMEADLLCLDQKNLKNLPYDASLGSLHPSITQTVEENKPQPLLSSETEATHQLASTPMSNPTSLANIDFYAQVSDITPAGGDVLSPGQKIKAGIAQGNTQREVATPCQENYSMNSAYFCESDAKKCIAVARRMEATSCIKPSFNQEDIYITTESLTTTAQMSETADIAPDAEMSVPDYTTVHTVQSPRGLILNATALPLPDKKNFPSSCGYVSTDQLNKIMQ
Tissue specificity：Expressed in all tissues tested including, liver, heart, adipose tissue, mammary gland, testes, ovary, brain, kidney and muscle. Highest levels in liver.
Induction：
Developmental stage：During gestation, both hepatic and serum expression begins at day 9. Levels increased 8-fold in liver and 30-fold in serum by late gestation. Levels of isoform 1 and isoform 2 similarly begin at day 9 with isoform 1 expression reaching maximum levels by day 13, isoform 2 levels continue to increase until the end of pregnancy. {ECO:0000269|PubMed:12379490}.
Protein families：Type I cytokine receptor family, Type 1 subfamily