LRC73_RAT Q587K4
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q587K4
Recommended name:Leucine-rich repeat-containing protein 73
EC number:
Alternative names:
Cleaved into:
GeneID:501101
Gene names (primary ):Lrrc73
Gene names (synonym ):Nod3l
Gene names (ORF ):
Length:316
Mass:33,377
Sequence:MLPSSIQISGEPLSGAEVRDICRGLRDNAVRLLSLRGCRLCDRDFGRICRALAGATSLAQLNLNLGVVSSPSRIKQLAEALRTNRSIQSLFLHGSPLTDAGLALLNPALALHPALVALDLGDCMLGDEAINLICGLLPPDGAKSGLKELTLSANPGITPKGWSRLAIAVAHSSQVRVLNLDYNPLGDHVAGMLAVAVASSRTLEVLDLEGTGLTNQSAQTLLDMVENYPTALRSLVLAENSISPELQQQICDLLSEGEEEEEMAGGAADTQEWGRGREPAAHQRGGSSWKCPSDPNSQMVLMTSGLGDSLLAETEM
Tissue specificity:
Induction:
Developmental stage:
Protein families: