NGN3_MOUSE   P70661


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:P70661

Recommended name:Neurogenin-3

EC number:

Alternative names:(NGN-3) (Helix-loop-helix protein mATH-4B) (mATH4B) (Protein atonal homolog 5)

Cleaved into:

GeneID:11925

Gene names  (primary ):Neurog3

Gene names  (synonym ):Ath4b Atoh5 Ngn3

Gene names  (ORF ):

Length:214

Mass:23267

Sequence:MAPHPLDALTIQVSPETQQPFPGASDHEVLSSNSTPPSPTLIPRDCSEAEVGDCRGTSRKLRARRGGRNRPKSELALSKQRRSRRKKANDRERNRMHNLNSALDALRGVLPTFPDDAKLTKIETLRFAHNYIWALTQTLRIADHSFYGPEPPVPCGELGSPGGGSNGDWGSIYSPVSQAGNLSPTASLEEFPGLQVPSSPSYLLPGALVFSDFL

Tissue specificity:

Induction:

Developmental stage:

Protein families:


   💬 WhatsApp