SAST_RAT   P08635


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:P08635

Recommended name:S-acyl fatty acid synthase thioesterase, medium chain 1 Publication

EC number:EC:3.1.2.14

Alternative names:Medium-chain S-acyl fatty acid synthetase thioester hydrolase 1 Publication Oleoyl-ACP hydrolase Thioesterase II Thioesterase domain-containing protein 1

Cleaved into:

GeneID:64669

Gene names  (primary ):Olah

Gene names  (synonym ):Mch 1 Publication, Thedc1

Gene names  (ORF ):

Length:263

Mass:29,471

Sequence:METAVNAKSPRNEKVLNCLYQNPDAVFKLICFPWAGGGSIHFAKWGQKINDSLEVHAVRLAGRETRLGEPFANDIYQIADEIVTALLPIIQDKAFAFFGHSFGSYIALITALLLKEKYKMEPLHIFVSGASAPHSTSRPQVPDLNELTEEQVRHHLLDFGGTPKHLIEDQDVLRMFIPLLKADAGVVKKFIFDKPSKALLSLDITGFLGSEDTIKDIEGWQDLTSGKFDVHMLPGDHFYLMKPDNENFIKNYIAKCLELSSLT

Tissue specificity:

Induction:

Developmental stage:

Protein families:


   💬 WhatsApp