SF3B6_MOUSE P59708
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:P59708
Recommended name：Splicing factor 3B subunit 6
EC number：
Alternative names：(Pre-mRNA branch site protein p14) (SF3b 14 kDa subunit)
Cleaved into：
GeneID：66055
Gene names (primary )：Sf3b6
Gene names (synonym )：Sf3b14
Gene names (ORF )：
Length：125
Mass：14585
Sequence：MAMQAAKRANIRLPPEVNRILYIRNLPYKITAEEMYDIFGKYGPIRQIRVGNTPETRGTAYVVYEDIFDAKNACDHLSGFNVCNRYLVVLYYNANRAFQKMDTKKKEEQLKLLKEKYGINTDPPK
Tissue specificity：
Induction：
Developmental stage：
Protein families：