PA2G5_HUMAN P39877
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:P39877
Recommended name：Phospholipase A2 group V
EC number：EC:3.1.1.4
Alternative names：(PLA2-10) (Phosphatidylcholine 2-acylhydrolase 5)
Cleaved into：
GeneID：5322
Gene names (primary )：PLA2G5
Gene names (synonym )：
Gene names (ORF )：
Length：138
Mass：15674
Sequence：MKGLLPLAWFLACSVPAVQGGLLDLKSMIEKVTGKNALTNYGFYGCYCGWGGRGTPKDGTDWCCWAHDHCYGRLEEKGCNIRTQSYKYRFAWGVVTCEPGPFCHVNLCACDRKLVYCLKRNLRSYNPQYQYFPNILCS
Tissue specificity：Heart, placenta and less abundantly, in lung. Detected in the outer and inner plexiform layers of the retina (at protein level) (PubMed:22137173). Expressed in monocytes and macrophages (PubMed:25725101). {ECO:0000269|PubMed:22137173, ECO:0000269|PubMed:25725101}.
Induction：Up-regulated upon M2 macrophage polarization in response to IL4, CSF1 or IL10. {ECO:0000269|PubMed:25725101}.
Developmental stage：
Protein families：Phospholipase A2 family