EIF3F_MOUSE   Q9DCH4


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q9DCH4

Recommended name:Eukaryotic translation initiation factor 3 subunit F

EC number:EC 3.4.19.12

Alternative names:(eIF3f) (Deubiquitinating enzyme eIF3f) (Eukaryotic translation initiation factor 3 subunit 5) (eIF-3-epsilon) (eIF3 p47)

Cleaved into:

GeneID:66085

Gene names  (primary ):Eif3f

Gene names  (synonym ):Eif3s5

Gene names  (ORF ):

Length:361

Mass:37984

Sequence:MASPAVPANVPPATAAAAPAPVVTAAPASAPTPSTPAPTPAATPAASPAPVSSDPAVAAPAAPGQTPASAPAPAQTPAPSQPGPALPGPFPGGRVVRLHPVILASIVDSYERRNEGAARVIGTLLGTVDKHSVEVTNCFSVPHNESEDEVAVDMEFAKNMYELHKKVSPNELILGWYATGHDITEHSVLIHEYYSREAPNPIHLTVDTGLQHGRMSIKAYVSTLMGVPGRTMGVMFTPLTVKYAYYDTERIGVDLIMKTCFSPNRVIGLSSDLQQVGGASARIQDALSTVLQYAEDVLSGKVSADNTVGRFLMSLVNQVPKIVPDDFETMLNSNINDLLMVTYLANLTQSQIALNEKLVNL

Tissue specificity:

Induction:

Developmental stage:

Protein families:EIF-3 subunit F family


   💬 WhatsApp