CSAD_MOUSE Q9DBE0
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q9DBE0
Recommended name:Cysteine sulfinic acid decarboxylase
EC number:EC 4.1.1.29
Alternative names:(Aspartate 1-decarboxylase) (Cysteine-sulfinate decarboxylase) (Sulfinoalanine decarboxylase)
Cleaved into:
GeneID:246277
Gene names (primary ):Csad
Gene names (synonym ):
Gene names (ORF ):
Length:493
Mass:55145
Sequence:MADSKPLRTLDGDPVAVEALLQDVFGIVVDEAILKGTSASEKVCEWKEPEELKQLLDLELQSQGESREQILERCRTVIHYSVKTGHPRFFNQLFSGLDPHALAGRIITESLNTSQYTYEIAPVFVLMEEEVLKKLRALVGWNSGDGVFCPGGSISNMYAMNLARFQRYPDCKQRGLRALPPLALFTSKECHYSITKGAAFLGLGTDSVRVVKADERGRMIPEDLERQIILAEAEGSVPFLVSATSGTTVLGAFDPLDAIADVCQRHGLWFHVDAAWGGSVLLSRTHRHLLDGIQRADSVAWNPHKLLAAGLQCSALLLRDTSNLLKRCHGSQASYLFQQDKFYDVALDTGDKVVQCGRRVDCLKLWLMWKAQGGQGLERRIDQAFALTRYLVEEIKKREGFELVMEPEFVNVCFWFVPPSLRGKKESPDYSQRLSQVAPVLKERMVKKGTMMIGYQPHGTRANFFRMVVANPILAQADIDFLLGELELLGQDL
Tissue specificity:Expressed in kidney and liver not detected in lymphoid tissues and lung. Expressed in kidney, liver and brain. 7 and 4 times higher expression in kidney and liver than in brain, respectively. Low level of detection in skeletal muscle. Expressed in brain, olfactory bulb, liver, skeletal muscle and kidney with the highest expression in liver and lowest in skeletal muscle (at protein level) (PubMed:26327310). {ECO:0000269|PubMed:11997111, ECO:0000269|PubMed:26327310}.
Induction:
Developmental stage:Expression in the brain decreases with age as detected from 17 dpc to 12 months. {ECO:0000269|PubMed:26327310}.
Protein families:Group II decarboxylase family