PCOTH_HUMAN   Q58A44


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q58A44

Recommended name:Prostate collagen triple helix protein

EC number:

Alternative names:(C1QTNF9B antisense RNA 1) (C1QTNF9B antisense gene protein 1)

Cleaved into:

GeneID:542767

Gene names  (primary ):PCOTH

Gene names  (synonym ):C1QTNF9B-AS1

Gene names  (ORF ):

Length:107

Mass:10968

Sequence:MWILSNLMGTSEEGNLLSTVSPTVKALFGKTRVSPIFPFSPRSPFQPLIPRTPGSPWGPVGPASPLGPGFPIGPMGPGKPVGPKGPMLPLGPSGPVGPTSPLFPFCP

Tissue specificity:Expressed in prostate and testis. Weakly or not expressed in other tissues. Overexpressed in prostate cancers. {ECO:0000269|PubMed:15930275}.

Induction:

Developmental stage:

Protein families:


   💬 WhatsApp