KCNK1_RAT Q9Z2T2
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q9Z2T2
Recommended name:Potassium channel subfamily K member 1
EC number:
Alternative names:
Cleaved into:
GeneID:59324
Gene names (primary ):Kcnk1
Gene names (synonym ):
Gene names (ORF ):
Length:336
Mass:38,228
Sequence:MLQSLAGSSCVRLVERHRSAWCFGFLVLGYLLYLVFGAVVFSSVELPYEDLLRQELRKLKRRFLEEHECLSEPQLEQFLGRVLEASNYGVSVLSNASGNWNWDFTSALFFASTVLSTTGYGHTVPLSDGGKAFCIIYSVIGIPFTLLFLTAVVQRVTVHVTRRPVLYFHIRWGFSKQVVAIVHAVLLGFVTVSCFFFIPAAVFSVLEDDWNFLESFYFCFISLSTIGLGDYVPGEGYNQKFRELYKIGITCYLLLGLIAMLVVLETFCELHELKKFRKMFYVKKDKDEDQVHIMEHDQLSFSSITEQAAGLKEEQKQNEPFVASQSPPYEDGSANH
Tissue specificity:Detected in brain and in kidney cortex and medulla, especially at the renal brush border membranes of the proximal convoluted tubules, in distal tubules and on intercalated cells of the collecting duct (PubMed:9843722). Detected in cerebellum granule neurons (PubMed:23169818, PubMed:25305496). Detected in astrocytes in hippocampus stratum radiatum (PubMed:19571146). Highly expressed in the stria vascularis in the cochlea (PubMed:12855359). Detected in neurons in Scarpa's ganglion in the inner ear, at nerve terminals in the crista ampullaris, in supporting cells and dark cells, but not in hair cells (PubMed:18838117) (at protein level). Detected in the brain cerebellar granule cell layer, amygdala, thalamus reticular nucleus, habenula, mesencephalic trigeminal neurons, neocortex and piriform cortex, and at lower levels in the olfactory bulb (PubMed:11567039). Detected in Scarpa's ganglia and crista ampullaris in the inner ear (PubMed:18838117). 7 s
Induction:
Developmental stage:
Protein families: