B9D2_MOUSE Q3UK10
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q3UK10
Recommended name：B9 domain-containing protein 2
EC number：
Alternative names：(Stumpy)
Cleaved into：
GeneID：232987
Gene names (primary )：B9d2
Gene names (synonym )：
Gene names (ORF )：
Length：175
Mass：19250
Sequence：MAEVHVIGQIIGATGFSESSLFCKWGIHTGAAWKLLSGVREGQTQVDTPQIGDMAYWSHPIDLHFATKGLQGWPRLHLQVWSQDSFGRCQLAGYGFCHVPSSPGTHQLDCPTWRPLGSWREQLARAFVGGGPQLLHADTIYSGADRYRLHTAAGGTVHLGIGLLLRHFDRYGVEC
Tissue specificity：Highest expression in thymus and skeletal muscle. Also expressed in spleen, kidney, lung, heart, microglia and liver. Detected in brain (at protein level). {ECO:0000269|PubMed:18287022}.
Induction：
Developmental stage：
Protein families：B9D family