IL40_MOUSE Q9CX63
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q9CX63
Recommended name:Protein IL-40
EC number:
Alternative names:(Interleukin-40) (IL-40)
Cleaved into:
GeneID:77727
Gene names (primary ):
Gene names (synonym ):
Gene names (ORF ):
Length:252
Mass:26851
Sequence:MALLQLLLFAMLAACGFSEEQTEGITIAYKVLEVYPQSRRVLITCDAPEASQPITYSLLASRGILVAKKVVHDSVPASFNINITIKSSPDLLTYSCQATSNSGTYGPSSRLQMYQELWAKPVSQLQADFVLRHGDSGPTVELSCLASSGSPPITYRLVGNGGRVLAQQRPLHGKPANFSLPLSQTTGWFQCEAENDVGVDSSARIPLPRAEARAKLVTTLAGELPLTPTCILAGSLVSIAVIASRMLSSTGL
Tissue specificity:Expressed in bone marrow, spleen and lymph node (PubMed:28978694). {ECO:0000269|PubMed:28978694}.
Induction:Up-regulated in the mammary gland upon the onset of lactation (PubMed:28978694). Up-regulated in peripheral blood lymphocyte B cells upon activation (PubMed:28978694). {ECO:0000269|PubMed:28978694}.
Developmental stage:
Protein families: