LN28A_HUMAN Q9H9Z2
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q9H9Z2
Recommended name：Protein lin-28 homolog A
EC number：
Alternative names：(Lin-28A) (Zinc finger CCHC domain-containing protein 1)
Cleaved into：
GeneID：79727
Gene names (primary )：LIN28A
Gene names (synonym )：CSDD1 LIN28 ZCCHC1
Gene names (ORF )：
Length：209
Mass：22743
Sequence：MGSVSNQQFAGGCAKAAEEAPEEAPEDAARAADEPQLLHGAGICKWFNVRMGFGFLSMTARAGVALDPPVDVFVHQSKLHMEGFRSLKEGEAVEFTFKKSAKGLESIRVTGPGGVFCIGSERRPKGKSMQKRRSKGDRCYNCGGLDHHAKECKLPPQPKKCHFCQSISHMVASCPLKAQQGPSAQGKPTYFREEEEEIHSPTLLPEAQN
Tissue specificity：Expressed in embryonic stem cells, placenta and testis. Tends to be up-regulated in HER2-overexpressing breast tumors. {ECO:0000269|PubMed:14688391, ECO:0000269|PubMed:15614775, ECO:0000269|PubMed:15722555, ECO:0000269|PubMed:22118463}.
Induction：Can be negatively regulated by the interaction of microRNAs miR-125a and miR-125b with at least two miRNA responsive elements (miREs) in the 3'-UTR of this gene. These interactions may reduce both translation efficiency and mRNA abundance. Negatively regulated by retinoic acid. {ECO:0000269|PubMed:15003116, ECO:0000269|PubMed:16227573}.
Developmental stage：Expressed in fetal liver. Expression decreases during differentiation of ES cells or upon induction of neuronal differentiation by retinoic acid. {ECO:0000269|PubMed:14688391, ECO:0000269|PubMed:15614775, ECO:0000269|PubMed:15722555}.
Protein families：Lin-28 family