DYLT1_HUMAN   P63172


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:P63172

Recommended name:Dynein light chain Tctex-type 1

EC number:

Alternative names:(Protein CW-1) (T-complex testis-specific protein 1 homolog)

Cleaved into:

GeneID:6993

Gene names  (primary ):DYNLT1

Gene names  (synonym ):TCTEL1 TCTEX-1 TCTEX1

Gene names  (ORF ):

Length:113

Mass:12452

Sequence:MEDYQAAEETAFVVDEVSNIVKEAIESAIGGNAYQHSKVNQWTTNVVEQTLSQLTKLGKPFKYIVTCVIMQKNGAGLHTASSCFWDSSTDGSCTVRWENKTMYCIVSAFGLSI

Tissue specificity:Expressed in heart, placenta, skeletal muscle kidney, pancreas, spleen, prostate, testis, ovary, ileum and colon. Expressed in lung endothelial and smooth muscle cells (at protein level). {ECO:0000269|PubMed:14583445}.

Induction:

Developmental stage:

Protein families:Dynein light chain Tctex-type family


   💬 WhatsApp