HMGA1_MOUSE   P17095


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:P17095

Recommended name:High mobility group protein HMG-I/HMG-Y

EC number:

Alternative names:(HMG-I(Y)) (High mobility group AT-hook protein 1) (High mobility group protein A1)

Cleaved into:

GeneID:111241

Gene names  (primary ):Hmga1

Gene names  (synonym ):Hmgi Hmgiy

Gene names  (ORF ):

Length:107

Mass:11614

Sequence:MSESGSKSSQPLASKQEKDGTEKRGRGRPRKQPPVSPGTALVGSQKEPSEVPTPKRPRGRPKGSKNKGAAKTRKVTTAPGRKPRGRPKKLEKEEEEGISQESSEEEQ

Tissue specificity:

Induction:

Developmental stage:

Protein families:HMGA family