SH3G3_RAT   O35180


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:O35180

Recommended name:Endophilin-A3

EC number:

Alternative names:

Cleaved into:

GeneID:81921

Gene names  (primary ):Sh3gl3

Gene names  (synonym ):Sh3d2c1, Sh3p13

Gene names  (ORF ):

Length:347

Mass:39,166

Sequence:MSVAGLKKQFHKASQLFSEKISGAEGTKLDEEFLDMEKKIDITSKAVAEILSKATEYLQPNPAYRAKLGMLNTMSKLRGQVKATGYPQTEGLLGDCMLKYGRELGEDSAFGNSLVEVGEALKLMAEVKDSLDINVKQTFIDPLQLLQDKDLKEIGHHLRKLEGRRLDYDYKKKRVGKIPEEEIRQAVEKFEESKELAERSMFNFLENDVEQVSQLAVFVEAALDYHRQSTEILQELQNKLELRIALASQVPRRDYMPKPVNTSSTNANGVEPSSSSKLTGTDIPSDQPCCRGLYDFEPENEGELGFKEGDIITLTNQIDENWYEGMLRGESGFFPINYVEVIVPLPR

Tissue specificity:Expressed at high level in testis and at lower level in brain and liver. 2 s

Induction:

Developmental stage:

Protein families:endophilin family


   💬 WhatsApp