LFG2_MOUSE Q8K097
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q8K097
Recommended name：Protein lifeguard 2
EC number：
Alternative names：(Fas apoptotic inhibitory molecule 2) (Neural membrane protein 35)
Cleaved into：
GeneID：72393
Gene names (primary )：Faim2
Gene names (synonym )：Kiaa0950 Lfg Lfg2 Nmp35
Gene names (ORF )：
Length：317
Mass：35258
Sequence：MTQGKLSVANKAPGTEGQQHQANGEKKDAPAVPSAPPSYEEATSGEGLKAGTFPQGPTAVPLHPSWAYVDPSGSSGYEGGFPAGHHEHFTTFSWDDQKVRRLFIRKVYTILLVQLLVTLAVVALFTFCDVVKDYVQANPGWYWASYAVFFATYLTLACCSGPRRHFPWNLILLTIFTLSMAYLTGMLSSYYNTTSVLLCLVITALVCLSVTIFSFQTKFDFTSCQGVLFVLLMTLFFSGLLLAVLLPFQYVPWLHAVYAVLGAGVFTLFLAFDTQLLMGNRRHSLSPEEYIFGALNIYLDIIYIFTFFLQLFGTNRE
Tissue specificity：Brain. Highly expressed in cerebellum, also found in cortex, olfactory bulb, and hippocampus. {ECO:0000269|PubMed:17635665, ECO:0000269|PubMed:21957071}.
Induction：
Developmental stage：
Protein families：BI1 family, LFG subfamily