CXD3_HUMAN Q8N144
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q8N144
Recommended name：Gap junction delta-3 protein
EC number：
Alternative names：(Connexin-31.9) (Cx31.9) (Gap junction alpha-11 protein) (Gap junction chi-1 protein)
Cleaved into：
GeneID：125111
Gene names (primary )：GJD3
Gene names (synonym )：GJA11 GJC1
Gene names (ORF )：
Length：294
Mass：31933
Sequence：MGEWAFLGSLLDAVQLQSPLVGRLWLVVMLIFRILVLATVGGAVFEDEQEEFVCNTLQPGCRQTCYDRAFPVSHYRFWLFHILLLSAPPVLFVVYSMHRAGKEAGGAEAAAQCAPGLPEAQCAPCALRARRARRCYLLSVALRLLAELTFLGGQALLYGFRVAPHFACAGPPCPHTVDCFVSRPTEKTVFVLFYFAVGLLSALLSVAELGHLLWKGRPRAGERDNRCNRAHEEAQKLLPPPPPPPPPPALPSRRPGPEPCAPPAYAHPAPASLRECGSGRGKASPATGRRDLAI
Tissue specificity：Expressed in vascular smooth muscle cells. Found in heart, colon, and artery (at protein level). Found in cerebral cortex, heart, liver, lung, kidney, spleen and testis. {ECO:0000269|PubMed:12154091, ECO:0000269|PubMed:12176752}.
Induction：
Developmental stage：
Protein families：Connexin family, Delta-type subfamily