DPM3_HUMAN   Q9P2X0


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q9P2X0

Recommended name:Dolichol-phosphate mannosyltransferase subunit 3

EC number:

Alternative names:(Dolichol-phosphate mannose synthase subunit 3) (DPM synthase subunit 3) (Dolichyl-phosphate beta-D-mannosyltransferase subunit 3) (Mannose-P-dolichol synthase subunit 3) (MPD synthase subunit 3) (Prostin-1)

Cleaved into:

GeneID:54344

Gene names  (primary ):DPM3

Gene names  (synonym ):

Gene names  (ORF ):

Length:92

Mass:10094

Sequence:MTKLAQWLWGLAILGSTWVALTTGALGLELPLSCQEVLWPLPAYLLVSAGCYALGTVGYRVATFHDCEDAARELQSQIQEARADLARRGLRF

Tissue specificity:

Induction:

Developmental stage:

Protein families:DPM3 family


   💬 WhatsApp