LHPL2_MOUSE Q8BGA2
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q8BGA2
Recommended name：LHFPL tetraspan subfamily member 2 protein
EC number：
Alternative names：(Lipoma HMGIC fusion partner-like 2 protein)
Cleaved into：
GeneID：218454
Gene names (primary )：Lhfpl2
Gene names (synonym )：
Gene names (ORF )：
Length：222
Mass：23873
Sequence：MCHVIVTCRSMLWTLLSIVVAFAELVAFMSADWLIGKAKTRSGSGDEQAGMNSEPHYLGILCIRTPAMQQVSRDTLCGTYAKSFGEIASGFWQATAIFLAVGIFILCVVALVSVFTMCVQSIMRKSIFNVCGLLQGIAGLFLILGLILYPAGWGCQKAIDCGRYASPYKPGDCSLGWAFYTATGGTVLTFICAVFSAQAEIATSSDKVQEEIEEGKNLVCLL
Tissue specificity：Expressed in the epithelium of the vas deferens (at protein level). Widely expressed (PubMed:26964900). Strongly expressed in heart, spleen, liver, kidney, thymus, testis, brain, lung, intestine, vagina, ovary and uterus (PubMed:26964900). Expressed in follicle cells of the ovary, epithelial cells of the oviduct, both luminal and glandular epithelial cells of the uterus, and epithelial cells of the vagina (PubMed:26964900). {ECO:0000269|PubMed:26964900}.
Induction：
Developmental stage：
Protein families：LHFP family