CAVN2_MOUSE Q63918
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q63918
Recommended name：Caveolae-associated protein 2
EC number：
Alternative names：(Cavin-2) (Phosphatidylserine-binding protein) (Serum deprivation-response protein)
Cleaved into：
GeneID：20324
Gene names (primary )：Cavin2
Gene names (synonym )：Sdpr Sdr
Gene names (ORF )：
Length：418
Mass：46764
Sequence：MGEDAAQAEKFQHPNTDMLQEKPSSPSPMPSSTPSPSLNLGSTEEAIRDNSQVNAVTVHTLLDKLVNMLDAVRENQHNMEQRQINLEGSVKGIQNDLTKLSKYQASTSNTVSKLLEKSRKVSAHTRAVRERLERQCVQVKRLENNHAQLLRRNHFKVLIFQEESEIPASVFVKEPVPSAAEGKEELADENKSLEETLHNVDLSSDDELPRDEEALEDSAEEKMEESRAEKIKRSSLKKVDSLKKAFSRQNIEKKMNKLGTKIVSVERREKIKKSLTPNHQKASSGKSSPFKVSPLSFGRKKVREGESSVENETKLEDQMQEDREEGSFTEGLSEASLPSGLMEGSAEDAEKSARRGNNSAVGSNADLTIEEDEEEEPVALQQAQQVRYESGYMLNSEEMEEPSEKQVQPAVLHVDQTA
Tissue specificity：Heart, adipose tissue, lung and endothelial cells (at protein level). Highly expressed in kidney and expressed at lower levels in liver, spleen, thymus, stomach, intestine and uterus. {ECO:0000269|PubMed:19546242, ECO:0000269|PubMed:23652019, ECO:0000269|PubMed:8241023}.
Induction：Up-regulated in response to cardiac hypertrophy and in serum-starved but not in density-dependent growth-arrested NIH3T3 cells. Down-regulated within 6 hours after the addition of serum or epidermal growth factor to serum-starved cells. {ECO:0000269|PubMed:18332105, ECO:0000269|PubMed:8241023}.
Developmental stage：Expression gradually increases during embryonic stages and reaches a maximum in neonates. {ECO:0000269|PubMed:18332105}.
Protein families：CAVIN family