E41LB_RAT   B2RYE5


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:B2RYE5

Recommended name:Band 4.1-like protein 4B

EC number:

Alternative names:

Cleaved into:

GeneID:500464

Gene names  (primary ):Epb41l4b

Gene names  (synonym ):Lulu2 By Similarity

Gene names  (ORF ):

Length:527

Mass:59,571

Sequence:MLRFLRRTFGRRSMQRYARGAAGRGAAGLGDERDGGPRGGPAAAASSSVLPAAPGGSVFPAGGGPLLTGGAAVHISASGAAKATLYCRVFLLDGTEVSVDLPKHAKGQDLFDQIVYHLDLVETDYFGLQFLDSAQVTHWLDHSKPIKKQMKVGPAYALHFRVKYYSSEPNNLREEFTRYLFVLQLRHDILSGKLKCPYETAVELAALCLQAELGECELPEHTPELVSEFRFIPNQTEAMEFDIFQRWKEYRGKSPAQAELSYLNKAKWLEMYGVDMHVVRGRDGCEYSLGLTPTGILIFEGANKIGLFFWPKITKMDFKKSKLTLVVVEDDDQGREQEHTFVFRLDSARTCKHLWKCAVEHHAFFRLRTPSNSKSARSDFIRLGSRFRFSGRTEYQATHGSRLRRTSTFERKPSKRYPSRRHSTFKASNPVIAAQLCSKTNPEVHNYQPQFHPNVHPSQPRWRPHSPNVSNHSTCKQNKPSFQDDRPHWKASASGDDGHFDYVHDQNQRNLGGAYSVTYRDKLMTAL

Tissue specificity:

Induction:

Developmental stage:

Protein families:


   💬 WhatsApp