VCX3_HUMAN   Q9NNX9


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q9NNX9

Recommended name:Variable charge X-linked protein 3

EC number:

Alternative names:(Variable charge protein on X with eight repeats) (VCX-8r) (Variably charged protein X-A) (VCX-A)

Cleaved into:

GeneID:51481

Gene names  (primary ):VCX3A

Gene names  (synonym ):VCX3 VCX8R VCXA

Gene names  (ORF ):

Length:186

Mass:20020

Sequence:MSPKPRASGPPAKATEAGKRKSSSQPSPSDPKKKTTKVAKKGKAVRRGRRGKKGAATKMAAVTAPEAESGPAAPGPSDQPSQELPQHELPPEEPVSEGTQHDPLSQESELEEPLSQESEVEEPLSQESQVEEPLSQESEVEEPLSQESQVEEPLSQESEVEEPLSQESQVEEPLSQESEMEELPSV

Tissue specificity:Expressed exclusively in testis.

Induction:

Developmental stage:

Protein families:VCX/VCY family


   💬 WhatsApp