FUCM_HUMAN   A2VDF0


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:A2VDF0

Recommended name:Fucose mutarotase

EC number:EC:5.1.3.29

Alternative names:

Cleaved into:

GeneID:282969

Gene names  (primary ):FUOM

Gene names  (synonym ):C10orf125

Gene names  (ORF ):

Length:154

Mass:16765

Sequence:MVALKGVPALLSPELLYALARMGHGDEIVLADLNFPASSICQCGPMEIRADGLGIPQLLEAVLKLLPLDTYVESPAAVMELVPSDKERGLQTPVWTEYESILRRAGCVRALAKIERFEFYERAKKAFAVVATGETALYGNLILRKGVLALNPLL

Tissue specificity:

Induction:

Developmental stage:

Protein families:RbsD / FucU family


   💬 WhatsApp