FRIH_MOUSE   P09528


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:P09528

Recommended name:Ferritin heavy chain

EC number:EC 1.16.3.1

Alternative names:(Ferritin H subunit)

Cleaved into:Ferritin heavy chain, N-terminally processed

GeneID:14319

Gene names  (primary ):Fth1

Gene names  (synonym ):Fth

Gene names  (ORF ):

Length:182

Mass:21067

Sequence:MTTASPSQVRQNYHQDAEAAINRQINLELYASYVYLSMSCYFDRDDVALKNFAKYFLHQSHEEREHAEKLMKLQNQRGGRIFLQDIKKPDRDDWESGLNAMECALHLEKSVNQSLLELHKLATDKNDPHLCDFIETYYLSEQVKSIKELGDHVTNLRKMGAPEAGMAEYLFDKHTLGHGDES

Tissue specificity:

Induction:

Developmental stage:At 9.5 dpc, detected at low levels in the developing heart and central nervous system. At later stages of development, widely expressed, predominantly in the heart and brown fat tissue. {ECO:0000269|PubMed:10652280}.

Protein families:Ferritin family


   💬 WhatsApp