QCR10_MOUSE   Q9CPX8


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q9CPX8

Recommended name:Cytochrome b-c1 complex subunit 10

EC number:

Alternative names:(Complex III subunit 10) (Complex III subunit XI) (Ubiquinol-cytochrome c reductase complex 6.4 kDa protein)

Cleaved into:

GeneID:66594

Gene names  (primary ):Uqcr11

Gene names  (synonym ):Uqcr

Gene names  (ORF ):

Length:56

Mass:6539

Sequence:MLSRFLGPRYRELARNWIPTAGMWGTVGAVGLVWATDWRLILDWVPYINGKFKKDD

Tissue specificity:

Induction:

Developmental stage:

Protein families:UQCR11/QCR10 family


   💬 WhatsApp