CS2LB_RAT   Q8CGR3


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q8CGR3

Recommended name:Alpha-S2-casein-like B

EC number:

Alternative names:

Cleaved into:

GeneID:286759

Gene names  (primary ):Csn1s2b

Gene names  (synonym ):Csnd

Gene names  (ORF ):

Length:169

Mass:19,846

Sequence:MKFIILTCLLAVALAKQESKDNSQEDFKQTVDVVIFPGQETVKNIPIPQMESVEAPIKNKCYQSIQTFKPPQALKGLYQYHMAKNPWGYTVNRAFPSTRTLQYNQKTMDLSMRAREKIVMSEIKKNIQDYVTKMKQYSKITWPRFVKSLQQYQKTMNPWSCYPYTLLQV

Tissue specificity:Mammary gland specific. Secreted in milk.

Induction:

Developmental stage:

Protein families:


   💬 WhatsApp