VMAC_RAT Q6QZQ4
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q6QZQ4
Recommended name：Vimentin-type intermediate filament-associated coiled-coil protein
EC number：
Alternative names：
Cleaved into：
GeneID：363327
Gene names (primary )：Vmac
Gene names (synonym )：
Gene names (ORF )：
Length：171
Mass：18,844
Sequence：MSAPPPLQIREANAHLAAVHRRAAELERRLLAAERTMRAQAERLACQDQQLRAALDELGRAKDREIFTLQEQLLSSEATVRSLQAAVEQRDQMIQELQPRADLLQDITRQRPPLAALLATLEEAEELGPLPSSHSHGAQLLPDGPGPPLGNSMREEEGQDDQQPAVFGTTV
Tissue specificity：Expressed in brain, heart, kidney, liver, lung, skeletal muscle, spleen and testis. Within the kidney expression is pronounced within glomeruli. 1
Induction：
Developmental stage：
Protein families：