DTWD1_RAT   Q6AYF5


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q6AYF5

Recommended name:tRNA-uridine aminocarboxypropyltransferase 1 Curated

EC number:EC:2.5.1.25

Alternative names:DTW domain-containing protein 1 Curated

Cleaved into:

GeneID:296119

Gene names  (primary ):Dtwd1

Gene names  (synonym ):

Gene names  (ORF ):

Length:304

Mass:34,903

Sequence:MALSPSVVPQESEENNANCVETKQSQTASTASEDPLQHLCLASQEVLHKAQQSGRSRCLQCGGSRMFYCYTCYVPVENVPTEQIPFVQLPLKIDIIKHPNETDGKSTAVHAKLLAPDSVNIYTYPCIPEYEGQDHEVVLVFPGPQSISIKDVSFHLQKRIESKGGDKADDLDMPPRKLVRTEAQEGWHLNESMGKGPELKRVVFIDSTWSQTNQITSDERLRELLQVELKTRKTCFWRHQKGKPDTFLSTIEAIYYFLVDYHRAVQKEEYRGQYDNLLFFYSFMYRLIKEARRSGEKAKQKPIH

Tissue specificity:

Induction:

Developmental stage:

Protein families:


   💬 WhatsApp