SCPPQ_RAT D6QY17
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:D6QY17
Recommended name：Secretory calcium-binding phosphoprotein proline-glutamine-rich protein 1
EC number：
Alternative names：
Cleaved into：
GeneID：100359907
Gene names (primary )：Scpppq1
Gene names (synonym )：
Gene names (ORF )：
Length：90
Mass：9,764
Sequence：MKLLLLASLLSAAAALPIPLGQSGGSSSEQRFNLYPPQILPFFPQFPLPQAPLIPIPFPFPFDPNQVLTPNQLLALITSILNQLQGFLGR
Tissue specificity：Restricted to tooth and associated tissues (PubMed:16674676, PubMed:25193156). Localised to the junctional epithelium at the cell-tooth interface (PubMed:25193156). 2 s
Induction：
Developmental stage：Specifically expressed in ameloblasts during maturation stages. Not detected in secretory or post-secretory transition stage ameloblasts. 1
Protein families：