PKHB1_RAT   Q9WU68


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q9WU68

Recommended name:Pleckstrin homology domain-containing family B member 1

EC number:

Alternative names:Evectin-1

Cleaved into:

GeneID:64471

Gene names  (primary ):Plekhb1

Gene names  (synonym ):Evt1, Kpl1

Gene names  (ORF ):

Length:223

Mass:25,244

Sequence:MALVRGGWLWRQSSILRRWKRNWFALWLDGTLGYYHDETAQDEEDRVVIHFNVRDIKVGQECQDVQPPEGRSRDGLLTVNLREGSRLHLCAETRDDAIAWKTALMEANSTPAPAGATVPPRSRRVCPKVRCTSLSWKPCKVERRIWVRVYSPYQDYYEVVPPNAHEATYVRSYYGPPYGPGVTHVIVREDPCYSSGAPLAMGMLAGAATGAALGSLMWSPCWF

Tissue specificity:Highly expressed in photoreceptor cells, oligodendrocytes and throughout the myelinated parts of the central nervous system. Detected in brain, liver, kidney, spleen and trachea. 2 s

Induction:

Developmental stage:

Protein families:


   💬 WhatsApp