DDT4L_RAT Q8VD50
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q8VD50
Recommended name：DNA damage-inducible transcript 4-like protein
EC number：
Alternative names：
Cleaved into：
GeneID：100363484
Gene names (primary )：Ddit4l
Gene names (synonym )：Smhs1
Gene names (ORF )：
Length：193
Mass：21,400
Sequence：MVATGSLSSKNTASISELLDGGSHPGSLLSDFDYWDYVVPEPNLNEVVFEETTCQNLVKMLENCLSKSKQTKLGCSKVLVPEKLTQRIAQDVLRLSSTEPCGLRGCVMHVNLEIENVCKKLDRIVCDASVVPTFELTLVFKQESCSWTSLKDFFFSGGRFSSGLRRTLILSSGFRLVKKKLYSLIGTTVIEEC
Tissue specificity：Expressed in heart, skeletal muscle and testis. 1
Induction：
Developmental stage：Up-regulated in soleus muscle atrophied by disuse. 1
Protein families：